English name: DSPE-PEG-MPG (Distearoylphosphatidylethanolamine-polyethylene glycol-PH responsive cell penetrating peptide)
Brand: SunLipo NanoTech
Specification: PEG molecular weight: 2000; 3000; 5000
Product description: peptide sequence ACGALFLGFLGAAGSTMGAWSQPKKKRKVCYS
Packaging container: Ampere bottle/plastic bottle
Aseptic processing: No
Storage conditions: frozen at minus 20 degrees
Shelf life: 12 months
Warm tips: Suzhou Beike nano products are only used for scientific research, not for human body,different batches of products have different specifications and performance |
Message
|
![](image/erweima.jpg) |
Scan code concerns WeChat official account
QQCommunication group£º1092348845
|
|
Warm tips: Suzhou Beike nano products are only used for scientific research, not for human body,different batches of products have different specifications and performance.The website pictures are from the Internet. The pictures are for reference only. Please take the real object as the standard. In case of infringement, please contact us to delete them immediately. |